PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G62470.1
Common NameATMYB96, MYB96, MYBCOV1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 351aa    MW: 39031.3 Da    PI: 5.8446
Description myb domain protein 96
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G62470.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.4e-181460148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++ + g  R+ k+c++rw +yl
      AT5G62470.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTHTG-LRCSKSCRLRWTNYL 60
                     79******************************.9************97 PP

2Myb_DNA-binding507.1e-1666111148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
      AT5G62470.1  66 RGNFTEHEEKTIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 111
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.788964IPR017930Myb domain
SuperFamilySSF466892.64E-3011107IPR009057Homeodomain-like
SMARTSM007179.3E-161362IPR001005SANT/Myb domain
PfamPF002491.6E-171460IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-251567IPR009057Homeodomain-like
CDDcd001672.50E-131660No hitNo description
SMARTSM007171.7E-1565113IPR001005SANT/Myb domain
PROSITE profilePS5129419.27565115IPR017930Myb domain
PfamPF002493.3E-1466111IPR001005SANT/Myb domain
CDDcd001677.73E-1168111No hitNo description
Gene3DG3DSA:1.10.10.603.8E-2468116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0010468Biological Processregulation of gene expression
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000027anatomylateral root tip
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MGRPPCCEKI GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTHTGLRCSK SCRLRWTNYL  60
RPGIKRGNFT EHEEKTIVHL QALLGNRWAA IASYLPERTD NDIKNYWNTH LKKKLKKINE  120
SGEEDNDGVS SSNTSSQKNH QSTNKGQWER RLQTDINMAK QALCEALSLD KPSSTLSSSS  180
SLPTPVITQQ NIRNFSSALL DRCYDPSSSS SSTTTTTTSN TTNPYPSGVY ASSAENIARL  240
LQDFMKDTPK ALTLSSSSPV SETGPLTAAV SEEGGEGFEQ SFFSFNSMDE TQNLTQETSF  300
FHDQVIKPEI TMDQDHGLIS QGSLSLFEKW LFDEQSHEMV GMALAGQEGM F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-28141154105C-Myb DNA-Binding Domain
1mse_C2e-28141154105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.93030.0flower| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247455_at0.0
Expression AtlasAT5G62470-
AtGenExpressAT5G62470-
ATTED-IIAT5G62470-
Functional Description ? help Back to Top
Source Description
TAIREncodes a R2R3 type Myb transcription factor whose expression is strongly induced by abscisic acid. Mediates abscisic acid signaling during drought stress response.
Function -- GeneRIF ? help Back to Top
  1. It was proposed that MYB96 is a molecular link that mediates abscisic acid-auxin cross talk in drought stress response and lateral root growth, providing an adaptive strategy under drought stress conditions.
    [PMID: 19625633]
  2. MYB96 is a molecular link that mediates abscisic acid-salicylic acid crosstalks.
    [PMID: 20149112]
  3. Activation of cuticular wax biosynthesis by drought and abscisic acid requires MYB96.
    [PMID: 21398568]
  4. MYB96 directly regulates LTP3 expression.
    [PMID: 23404903]
  5. Transgenic Camelina plants overexpressing Arabidopsis MYB96 enhanced tolerance to drought. Deposition of epicuticular wax crystals and total wax loads increased significantly on the surfaces of transgenic leaves.
    [PMID: 24880908]
  6. The Arabidopsis MYB96 transcription factor plays a role in seed dormancy.
    [PMID: 25616734]
  7. MYB96-ABI4 module regulates lipid mobilization specifically in the embryo to ensure proper seed germination under suboptimal conditions.
    [PMID: 25869652]
  8. MYB96 integrates a multitude of environmental stress signals and acts as a master regulator in the determination of timing for seed germination.
    [PMID: 26313409]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00579DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G62470.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G62470
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1760010.0AF176001.1 Arabidopsis thaliana putative transcription factor (MYB96) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_851248.10.0Myb transcription factor
SwissprotQ9SCU71e-106MYB30_ARATH; Transcription factor MYB30
TrEMBLQ9SPG00.0Q9SPG0_ARATH; MYB96 transcription factor-like protein
STRINGAT5G62470.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Leonhardt N, et al.
    Microarray expression analyses of Arabidopsis guard cells and isolation of a recessive abscisic acid hypersensitive protein phosphatase 2C mutant.
    Plant Cell, 2004. 16(3): p. 596-615
    [PMID:14973164]
  4. Tepperman JM, et al.
    Expression profiling of phyB mutant demonstrates substantial contribution of other phytochromes to red-light-regulated gene expression during seedling de-etiolation.
    Plant J., 2004. 38(5): p. 725-39
    [PMID:15144375]
  5. Devoto A, et al.
    Expression profiling reveals COI1 to be a key regulator of genes involved in wound- and methyl jasmonate-induced secondary metabolism, defence, and hormone interactions.
    Plant Mol. Biol., 2005. 58(4): p. 497-513
    [PMID:16021335]
  6. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  7. Seo PJ, et al.
    The MYB96 transcription factor mediates abscisic acid signaling during drought stress response in Arabidopsis.
    Plant Physiol., 2009. 151(1): p. 275-89
    [PMID:19625633]
  8. Seo PJ,Park CM
    Auxin homeostasis during lateral root development under drought condition.
    Plant Signal Behav, 2009. 4(10): p. 1002-4
    [PMID:19826230]
  9. Seo PJ,Park CM
    MYB96-mediated abscisic acid signals induce pathogen resistance response by promoting salicylic acid biosynthesis in Arabidopsis.
    New Phytol., 2010. 186(2): p. 471-83
    [PMID:20149112]
  10. Seo PJ, et al.
    The MYB96 transcription factor regulates cuticular wax biosynthesis under drought conditions in Arabidopsis.
    Plant Cell, 2011. 23(3): p. 1138-52
    [PMID:21398568]
  11. Seo PJ,Park CM
    Cuticular wax biosynthesis as a way of inducing drought resistance.
    Plant Signal Behav, 2011. 6(7): p. 1043-5
    [PMID:21617381]
  12. Meinke DW
    A survey of dominant mutations in Arabidopsis thaliana.
    Trends Plant Sci., 2013. 18(2): p. 84-91
    [PMID:22995285]
  13. Guo L,Yang H,Zhang X,Yang S
    Lipid transfer protein 3 as a target of MYB96 mediates freezing and drought stress in Arabidopsis.
    J. Exp. Bot., 2013. 64(6): p. 1755-67
    [PMID:23404903]
  14. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  15. Li-Beisson Y, et al.
    Acyl-lipid metabolism.
    Arabidopsis Book, 2013. 11: p. e0161
    [PMID:23505340]
  16. Lee SB,Kim H,Kim RJ,Suh MC
    Overexpression of Arabidopsis MYB96 confers drought resistance in Camelina sativa via cuticular wax accumulation.
    Plant Cell Rep., 2014. 33(9): p. 1535-46
    [PMID:24880908]
  17. Lee HG,Lee K,Seo PJ
    The Arabidopsis MYB96 transcription factor plays a role in seed dormancy.
    Plant Mol. Biol., 2015. 87(4-5): p. 371-81
    [PMID:25616734]
  18. Lee K,Lee HG,Yoon S,Kim HU,Seo PJ
    The Arabidopsis MYB96 Transcription Factor Is a Positive Regulator of ABSCISIC ACID-INSENSITIVE4 in the Control of Seed Germination.
    Plant Physiol., 2015. 168(2): p. 677-89
    [PMID:25869652]
  19. Lee K,Seo PJ
    Coordination of seed dormancy and germination processes by MYB96.
    Plant Signal Behav, 2015. 10(9): p. e1056423
    [PMID:26313409]